PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4BS_6253482BD.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 292aa    MW: 31795.9 Da    PI: 8.7189
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4BS_6253482BD.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.42.9e-171461148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g+WT+eEd++l+ ++k +G g+W++ ++  g+ R++k+c++rw +yl
  Traes_4BS_6253482BD.1 14 KGAWTKEEDQRLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61
                           79******************************99************97 PP

2Myb_DNA-binding60.92.8e-1967111147
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            rg++T+eEdel+++++++lG++ W++Ia +++ gRt++++k++w+++
  Traes_4BS_6253482BD.1  67 RGNFTEEEDELIIKLHELLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111
                            89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-24564IPR009057Homeodomain-like
PROSITE profilePS5129417.087961IPR017930Myb domain
SMARTSM007177.4E-141363IPR001005SANT/Myb domain
SuperFamilySSF466893.88E-3013108IPR009057Homeodomain-like
PfamPF002492.6E-151461IPR001005SANT/Myb domain
CDDcd001671.11E-111661No hitNo description
PROSITE profilePS5129429.5162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-2865116IPR009057Homeodomain-like
SMARTSM007172.0E-1866114IPR001005SANT/Myb domain
PfamPF002491.7E-1767111IPR001005SANT/Myb domain
CDDcd001671.20E-1469112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDQRLIAYIK AHGEGCWRSL PKAAGLLRCG KSCRLRWINY  60
LRPDLKRGNF TEEEDELIIK LHELLGNKWS LIAGRLPGRT DNEIKNYWNT HIKRKLLARG  120
MDPHTHRPLN AIAAAAMPAQ QQQQLRAAHE RHFAAATPGG HHLQPQQQDP FAALSSSAEP  180
ACSHSSDDEP AGSATPPPPS RRHLGIDLNL SISLAPYQPD DPAVKQEAAT TGSQNNATTS  240
TSAVCMCLNR LGFQGAGEGC RCGGASSVPM QQQASSAQRM FRFIAPLEGG GQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-30141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0547581e-158BT054758.1 Zea mays full-length cDNA clone ZM_BFb0028G03 mRNA, complete cds.
GenBankKJ7267961e-158KJ726796.1 Zea mays clone pUT2285 MYB transcription factor (MYB64) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015697509.11e-126PREDICTED: myb-related protein 308
SwissprotP813935e-91MYB08_ANTMA; Myb-related protein 308
TrEMBLW5EB490.0W5EB49_WHEAT; Uncharacterized protein
STRINGMLOC_65957.11e-179(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.13e-89myb domain protein 4
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]